Methionyl tRNA synthetase 2 Antibody
| Name | Methionyl tRNA synthetase 2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34013 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LLNSELADALGGLLNRCTAKRINPSETYPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCVRQTNG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Methionyl tRNA synthetase 2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MARS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Methionyl tRNA synthetase 2 Antibody [NBP2-34013] - Staining of human hippocampus shows strong nuclear and cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/325_Methionyl-tRNA-synthetase-2-Antibody-Immunohistochemistry-NBP2-34013-img0001.jpg)
Immunohistochemistry: Methionyl tRNA synthetase 2 Antibody [NBP2-34013] - Staining of human hippocampus shows strong nuclear and cytoplasmic positivity in neuronal cells.