Fbxl8 Antibody
| Name | Fbxl8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34012 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Fbxl8 Protein |
| Description | Rabbit Polyclonal |
| Gene | FBXL8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Fbxl8 Antibody [NBP2-34012] - staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6529_Fbxl8-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34012-img0002.jpg)
Immunocytochemistry/Immunofluorescence: Fbxl8 Antibody [NBP2-34012] - staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.
![Immunohistochemistry: Fbxl8 Antibody [NBP2-34012] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6530_Fbxl8-Antibody-Immunohistochemistry-NBP2-34012-img0001.jpg)
Immunohistochemistry: Fbxl8 Antibody [NBP2-34012] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.