TTC21A Antibody
| Name | TTC21A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34008 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: QGAESNYMEKKELEQQGVSTAEKLLREFYPHSDSSQTQLRLLQGLCRLATREKANMEAALGSFIQIAQAEKDSVPALLALAQAYVFLKQIPK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TTC21A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TTC21A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: TTC21A Antibody [NBP2-34008] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10027_TTC21A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34008-img0005.jpg)
Immunocytochemistry/Immunofluorescence: TTC21A Antibody [NBP2-34008] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & centrosome.
![Immunohistochemistry: TTC21A Antibody [NBP2-34008] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10028_TTC21A-Antibody-Immunohistochemistry-NBP2-34008-img0001.jpg)
Immunohistochemistry: TTC21A Antibody [NBP2-34008] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.