ACOXL Antibody
| Name | ACOXL Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34002 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RSLVIGEVLSMADMATGVKCGIIYWLFGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVIDTPCENAEKMY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ACOXL Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ACOXL |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ACOXL Antibody [NBP2-34002] - staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25344_ACOXL-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34002-img0002.jpg)
Immunocytochemistry/Immunofluorescence: ACOXL Antibody [NBP2-34002] - staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
![Immunohistochemistry-Paraffin: ACOXL Antibody [NBP2-34002] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25345_ACOXL-Antibody-Immunohistochemistry-Paraffin-NBP2-34002-img0001.jpg)
Immunohistochemistry-Paraffin: ACOXL Antibody [NBP2-34002] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.