CGI-16 Antibody
| Name | CGI-16 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90275 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWME |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CGI-16 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ACOT9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CGI-16 Antibody [NBP1-90275] - Analysis in human cell line RH-30.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16659_CGI-16-Antibody-Western-Blot-NBP1-90275-img0008.jpg)
Western Blot: CGI-16 Antibody [NBP1-90275] - Analysis in human cell line RH-30.
![Immunocytochemistry/Immunofluorescence: CGI-16 Antibody [NBP1-90275] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16660_CGI-16%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90275-img0009.jpg)
Immunocytochemistry/Immunofluorescence: CGI-16 Antibody [NBP1-90275] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: CGI-16 Antibody [NBP1-90275] - Staining of human bronchus shows strong granular cytoplasmic positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16661_CGI-16-Antibody-Immunohistochemistry-Paraffin-NBP1-90275-img0007.jpg)
Immunohistochemistry-Paraffin: CGI-16 Antibody [NBP1-90275] - Staining of human bronchus shows strong granular cytoplasmic positivity in respiratory epithelial cells.