Adrenomedullin R/ADMR/GPR182 Antibody
| Name | Adrenomedullin R/ADMR/GPR182 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90231 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Adrenomedullin R/ADMR/GPR182 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GPR182 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Adrenomedullin R/ADMR/GPR182 Antibody [NBP1-90231] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-20](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11731_Adrenomedullin-R-ADMR-GPR182-Antibody-Western-Blot-NBP1-90231-img0005.jpg)
Western Blot: Adrenomedullin R/ADMR/GPR182 Antibody [NBP1-90231] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-20
![Immunohistochemistry-Paraffin: Adrenomedullin R/ADMR/GPR182 Antibody [NBP1-90231] - Staining of human heart muscle shows strong positivity of intercalated discs.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11732_Adrenomedullin-R-ADMR-GPR182-Antibody-Immunohistochemistry-Paraffin-NBP1-90231-img0006.jpg)
Immunohistochemistry-Paraffin: Adrenomedullin R/ADMR/GPR182 Antibody [NBP1-90231] - Staining of human heart muscle shows strong positivity of intercalated discs.