KIF26B Antibody
| Name | KIF26B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90443 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SCHSFIAQTCFGHGEAMAEPVASEFVSSLQNTAVVCREKPKASPDNLLILSEMGDDSFNKAAPIKGCKISTVSKAMVTISNTANLS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KIF26B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KIF26B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: KIF26B Antibody [NBP1-90443] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & microtubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9763_KIF26B%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90443-img0005.jpg)
Immunocytochemistry/Immunofluorescence: KIF26B Antibody [NBP1-90443] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & microtubules.
![Immunohistochemistry-Paraffin: KIF26B Antibody [NBP1-90443] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9764_KIF26B-Antibody-Immunohistochemistry-Paraffin-NBP1-90443-img0004.jpg)
Immunohistochemistry-Paraffin: KIF26B Antibody [NBP1-90443] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.