PM20D2 Antibody
| Name | PM20D2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33925 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALASGCTVEIKGGAHDYYNVLPNKSLWKAYMENGRKLGIEFISEDTMLNGPSGSTDFG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PM20D2 Protein |
| Description | Rabbit Polyclonal |
| Gene | PM20D2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PM20D2 Antibody [NBP2-33925] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27142_PM20D2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33925-img0001.jpg)
Immunocytochemistry/Immunofluorescence: PM20D2 Antibody [NBP2-33925] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: PM20D2 Antibody [NBP2-33925] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27143_PM20D2%2520Antibody-Immunohistochemistry-Paraffin-NBP2-33925-img0002.jpg)
Immunohistochemistry-Paraffin: PM20D2 Antibody [NBP2-33925] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in Leydig cells.