PITPNM3 Antibody
| Name | PITPNM3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33894 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RFPLGDGQSLLLADALHTHSPLFLEGSSRDSPPLLDAPASPPQASRFQRPGRRMSEGSSHSESSESSDSMAPVGASRITAKWWGSKRIDYALYCPDV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PITPNM3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PITPNM3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: PITPNM3 Antibody [NBP2-33894] - Staining of human cell line HeLa shows localization to plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6061_PITPNM3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33894-img0004.jpg)
![Immunohistochemistry: PITPNM3 Antibody [NBP2-33894] - Staining of human spleen shows distinct positivity in sinusoids.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6062_PITPNM3-Antibody-Immunohistochemistry-NBP2-33894-img0001.jpg)