ATP6V1C2 Antibody

Name ATP6V1C2 Antibody
Supplier Novus Biologicals
Catalog NBP2-33978
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: VPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKE
Purity/Format Immunogen affinity purified
Blocking Peptide ATP6V1C2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene ATP6V1C2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.