C7orf36 Antibody
| Name | C7orf36 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33945 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GDVFDEEADESLLAQREWQSNMQRRVKEGYRDGIDAGKAVTLQQGFNQGYKKGAEVILNYGRLRGTLSALLSWCH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C7orf36 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | YAE1D1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C7orf36 Antibody [NBP2-33945] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10025_C7orf36%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33945-img0005.jpg)
Immunocytochemistry/Immunofluorescence: C7orf36 Antibody [NBP2-33945] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
![Immunohistochemistry-Paraffin: C7orf36 Antibody [NBP2-33945] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10026_C7orf36-Antibody-Immunohistochemistry-Paraffin-NBP2-33945-img0001.jpg)
Immunohistochemistry-Paraffin: C7orf36 Antibody [NBP2-33945] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.