ANKRD13C Antibody
| Name | ANKRD13C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90567 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LVNGLVLESRKRREHLSEEDILRNKAIMESLSKGGNIMEQNFEPIRRQSLTPPPQNTITWEEYISAENGKAPHLG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ANKRD13C Protein |
| Description | Rabbit Polyclonal |
| Gene | ANKRD13C |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: ANKRD13C Antibody [NBP1-90567] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27282_ANKRD13C-Antibody-Immunohistochemistry-Paraffin-NBP1-90567-img0002.jpg)
Immunohistochemistry-Paraffin: ANKRD13C Antibody [NBP1-90567] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
![Western Blot: ANKRD13C Antibody [NBP1-90567] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)<br/>Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1580_ANKRD13C%2520Antibody-Western%2520Blot-NBP1-90567-img0005.jpg)
Western Blot: ANKRD13C Antibody [NBP1-90567] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
![Western Blot: ANKRD13C Antibody [NBP1-90567] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1581_ANKRD13C-Antibody-Western-Blot-NBP1-90567-img0004.jpg)
Western Blot: ANKRD13C Antibody [NBP1-90567] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4