LSS Antibody
| Name | LSS Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-33966 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: MTEGTCLRRRGGPYKTEPATDLGRWRLNCERGRQTWTYLQDERAGREQTGLEAYALGLDTKNYFKDLPKAHTAFEGALNGMTF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | LSS Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | LSS |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LSS Antibody [NBP2-33966] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9025_LSS-Antibody-Western-Blot-NBP2-33966-img0004.jpg)
Western Blot: LSS Antibody [NBP2-33966] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
![Immunohistochemistry-Paraffin: LSS Antibody [NBP2-33966] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9026_LSS-Antibody-Immunohistochemistry-Paraffin-NBP2-33966-img0005.jpg)
Immunohistochemistry-Paraffin: LSS Antibody [NBP2-33966] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.