C7orf34 Antibody
| Name | C7orf34 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90611 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PKDGSQTEKTPSADQNQEQFEEHFVASSVGEMWQVVDMAQQEEDQSSKTAAVHKHSFHLSFCFSLASV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C7orf34 Protein |
| Description | Rabbit Polyclonal |
| Gene | C7orf34 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C7orf34 Antibody [NBP1-90611] - Staining of human cell line A-431 shows positivity in nucleus & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27348_C7orf34-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90611-img0003.jpg)
Immunocytochemistry/Immunofluorescence: C7orf34 Antibody [NBP1-90611] - Staining of human cell line A-431 shows positivity in nucleus & mitochondria.
![Immunohistochemistry-Paraffin: C7orf34 Antibody [NBP1-90611] - Immunohistochemical staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27349_C7orf34-Antibody-Immunohistochemistry-Paraffin-NBP1-90611-img0004.jpg)
Immunohistochemistry-Paraffin: C7orf34 Antibody [NBP1-90611] - Immunohistochemical staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.