C10orf120 Antibody
| Name | C10orf120 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90805 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NVSKHIERMRLARALGNHQPLPYIERFTRSSFLSGVGLGPMAKNKARRKEDNYDTHNCDDANQDKKEEAEG |
| Description | Rabbit Polyclonal |
| Gene | C10orf120 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C10orf120 Antibody [NBP1-90805] - Staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27635_C10orf120%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90805-img0004.jpg)
Immunocytochemistry/Immunofluorescence: C10orf120 Antibody [NBP1-90805] - Staining of human cell line A-431 shows positivity in plasma membrane & cytoplasm.
![Immunohistochemistry-Paraffin: C10orf120 Antibody [NBP1-90805] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27636_C10orf120%2520Antibody-Immunohistochemistry-Paraffin-NBP1-90805-img0002.jpg)
Immunohistochemistry-Paraffin: C10orf120 Antibody [NBP1-90805] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.