XK X-linked Kx blood group Antibody
| Name | XK X-linked Kx blood group Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87828 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | XK X-linked Kx blood group Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | XK |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25290_XK%2520X-linked%2520Kx%2520blood%2520group%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87828-img0007.jpg)
Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
![Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25291_XK-X-linked-Kx-blood-group-Antibody-Immunohistochemistry-Paraffin-NBP1-87828-img0006.jpg)
Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
![Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human cell line U-2 OS shows positivity in mitochondria and vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25292_XK-X-linked-Kx-blood-group-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87828-img0005.jpg)
Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human cell line U-2 OS shows positivity in mitochondria and vesicles.