GPR152 Antibody
| Name | GPR152 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87284 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GPR152 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GPR152 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: GPR152 Antibody [NBP1-87284] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-247](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6616_GPR152%2520Antibody-Western%2520Blot-NBP1-87284-img0004.jpg)
![Immunohistochemistry-Paraffin: GPR152 Antibody [NBP1-87284] - Staining of human testis shows strong cytoplasmic positivity in subsets of seminiferous duct cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6617_GPR152-Antibody-Immunohistochemistry-Paraffin-NBP1-87284-img0002.jpg)