C-Reactive Protein/CRP Antibody
| Name | C-Reactive Protein/CRP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87184 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C-Reactive Protein/CRP Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CSRP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: C-Reactive Protein/CRP Antibody [NBP1-87184] - Analysis in human plasma.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8490_C-Reactive%2520Protein-CRP%2520Antibody-Western%2520Blot-NBP1-87184-img0005.jpg)
![Immunohistochemistry-Paraffin: C-Reactive Protein/CRP Antibody [NBP1-87184] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8491_C-Reactive-Protein-CRP-Antibody-Immunohistochemistry-Paraffin-NBP1-87184-img0002.jpg)