C9orf25 Antibody
| Name | C9orf25 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88741 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MEEIDRFQVPTAHSEMQPLDPAAASISDGDCDAREGESVAMNYKPSPLQVKLEKQRELARKGSLKNGSM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C9orf25 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FAM219A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: C9orf25 Antibody [NBP1-88741] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, golgi apparatus and vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25057_C9orf25-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88741-img0003.jpg)
Immunocytochemistry/Immunofluorescence: C9orf25 Antibody [NBP1-88741] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli, golgi apparatus and vesicles.
![Immunohistochemistry-Paraffin: C9orf25 Antibody [NBP1-88741] - Staining of human pancreas shows distinct positivity in intercalated ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25058_C9orf25-Antibody-Immunohistochemistry-Paraffin-NBP1-88741-img0002.jpg)
Immunohistochemistry-Paraffin: C9orf25 Antibody [NBP1-88741] - Staining of human pancreas shows distinct positivity in intercalated ducts.
![Immunocytochemistry/Immunofluorescence: C9orf25 Antibody [NBP1-88741] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, the Golgi apparatus & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25059_C9orf25%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88741-img0004.jpg)
Immunocytochemistry/Immunofluorescence: C9orf25 Antibody [NBP1-88741] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, the Golgi apparatus & vesicles.