p40 (p63 delta) Antibody
| Name | p40 (p63 delta) Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88737 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | p40 (p63 delta) Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | EBNA1BP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: p40 (p63 delta) Antibody [NBP1-88737] - Staining of human prostate shows strong cytoplasmic positivity with a granular pattern in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20285_p40-(p63-delta)-Antibody-Immunohistochemistry-Paraffin-NBP1-88737-img0005.jpg)
Immunohistochemistry-Paraffin: p40 (p63 delta) Antibody [NBP1-88737] - Staining of human prostate shows strong cytoplasmic positivity with a granular pattern in glandular cells.