Cancer Antigen 1 Antibody
| Name | Cancer Antigen 1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-88734 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSVSYEKEVTAEGVERPEIVSTWSSAGISWRSEACRENCEMPDWEQSAESLQPVQEDMALNEVLQKLKHTNRKQEVRIQELQCSNL |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CAGE1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Cancer Antigen 1 Antibody [NBP1-88734] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27986_Cancer-Antigen-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88734-img0005.jpg)
Immunocytochemistry/Immunofluorescence: Cancer Antigen 1 Antibody [NBP1-88734] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.
![Immunohistochemistry-Paraffin: Cancer Antigen 1 Antibody [NBP1-88734] - Staining of human skeletal muscle shows moderate membranous positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/27987_Cancer-Antigen-1-Antibody-Immunohistochemistry-Paraffin-NBP1-88734-img0006.jpg)
Immunohistochemistry-Paraffin: Cancer Antigen 1 Antibody [NBP1-88734] - Staining of human skeletal muscle shows moderate membranous positivity.