ALDH1L1 Antibody
| Name | ALDH1L1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89414 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ILFGNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ALDH1L1 Protein |
| Description | Rabbit Polyclonal |
| Gene | ALDH1L1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ALDH1L1 Antibody [NBP1-89414] - Analysis in human cell line RT-4.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24767_ALDH1L1%2520Antibody-Western%2520Blot-NBP1-89414-img0005.jpg)
![Immunohistochemistry-Paraffin: ALDH1L1 Antibody [NBP1-89414] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24768_ALDH1L1-Antibody-Immunohistochemistry-Paraffin-NBP1-89414-img0002.jpg)