CCDC85C Antibody
| Name | CCDC85C Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34194 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PSAGYSPAGQKPEAVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CCDC85C Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CCDC85C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: CCDC85C Antibody [NBP2-34194] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25976_CCDC85C%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34194-img0005.jpg)
Immunocytochemistry/Immunofluorescence: CCDC85C Antibody [NBP2-34194] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles & cell junctions.
![Immunohistochemistry-Paraffin: CCDC85C Antibody [NBP2-34194] - Staining of human lateral ventricle shows weak cytoplasmic positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25977_CCDC85C-Antibody-Immunohistochemistry-Paraffin-NBP2-34194-img0006.jpg)
Immunohistochemistry-Paraffin: CCDC85C Antibody [NBP2-34194] - Staining of human lateral ventricle shows weak cytoplasmic positivity in neuronal cells.