HISPPD2A Antibody
| Name | HISPPD2A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89693 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:CLENSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVIQPYQEFSVEVGRLAQETSAINLLSQGIPEIDKPS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | HISPPD2A Protein |
| Description | Rabbit Polyclonal |
| Gene | PPIP5K1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25089_HISPPD2A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89693-img0004.jpg)
Immunocytochemistry/Immunofluorescence: HISPPD2A Antibody [NBP1-89693] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
![Immunohistochemistry-Paraffin: HISPPD2A Antibody [NBP1-89693] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25090_HISPPD2A-Antibody-Immunohistochemistry-Paraffin-NBP1-89693-img0002.jpg)
Immunohistochemistry-Paraffin: HISPPD2A Antibody [NBP1-89693] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.