Kanadaptin Antibody
| Name | Kanadaptin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89686 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ETQTHENMSQLSEEEQNKDYQDCSKTTSLCAGPSASKNEYEKSRGELKKKKTPGPGKLPPTLSSKYPEDDPDYCVWVPPEGQSGDGR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Kanadaptin Protein |
| Description | Rabbit Polyclonal |
| Gene | SLC4A1AP |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Kanadaptin Antibody [NBP1-89686] Staining of human cell line U-2 OS shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28133_Kanadaptin%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89686-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Kanadaptin Antibody [NBP1-89686] Staining of human cell line U-2 OS shows positivity in nucleus.
![Immunohistochemistry-Paraffin: Kanadaptin Antibody [NBP1-89686] - Staining of human breast shows moderate cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28134_Kanadaptin%2520Antibody-Immunohistochemistry-Paraffin-NBP1-89686-img0002.jpg)
Immunohistochemistry-Paraffin: Kanadaptin Antibody [NBP1-89686] - Staining of human breast shows moderate cytoplasmic and membranous positivity in glandular cells.