BCL7B Antibody
| Name | BCL7B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34097 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BCL7B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BCL7B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: BCL7B Antibody [NBP2-34097] - Staining of human pancreas shows moderate nuclear positivity in islets of Langerhans.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4339_BCL7B-Antibody-Immunohistochemistry-Paraffin-NBP2-34097-img0001.jpg)
Immunohistochemistry-Paraffin: BCL7B Antibody [NBP2-34097] - Staining of human pancreas shows moderate nuclear positivity in islets of Langerhans.