RNF98 Antibody
| Name | RNF98 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34120 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DSSQPFTLVTIGMQKFFIPKSPTSSNEPENRVLPMPTSIGIFLDCDKGKVNFYDMDQMKCLYERQVDCSHTLYPAFALMGSGGIQLEEPITAKYLEYQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RNF98 Protein |
| Description | Rabbit Polyclonal |
| Gene | TRIM36 |
| Supplier Page | Shop |
![Immunohistochemistry: RNF98 Antibody [NBP2-34120] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28248_RNF98-Antibody-Immunohistochemistry-NBP2-34120-img0002.jpg)
![Immunohistochemistry: RNF98 Antibody [NBP2-34120] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28249_RNF98-Antibody-Immunohistochemistry-NBP2-34120-img0001.jpg)
![Immunohistochemistry: RNF98 Antibody [NBP2-34120] - testis cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28250_RNF98%2520Antibody-Immunohistochemistry-NBP2-34120-img0003.jpg)