VIAAT/SLC32A1/VGAT Antibody
| Name | VIAAT/SLC32A1/VGAT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34117 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC32A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: VIAAT/SLC32A1/VGAT Antibody [NBP2-34117] - Staining of human retina shows strong cytoplasmic positivity in inner plexiform layer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3576_VIAAT-SLC32A1-VGAT%2520Antibody-Immunohistochemistry-Paraffin-NBP2-34117-img0007.jpg)
Immunohistochemistry-Paraffin: VIAAT/SLC32A1/VGAT Antibody [NBP2-34117] - Staining of human retina shows strong cytoplasmic positivity in inner plexiform layer.