UBE2QL1 Antibody
| Name | UBE2QL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-34154 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: NVKLHQVDKDSVLWQDMKETNTEFILLNLTFPDNFPFSPPFMRVLSPRLENGYVL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | UBE2QL1 Protein |
| Description | Rabbit Polyclonal |
| Gene | UBE2QL1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: UBE2QL1 Antibody [NBP2-34154] - gallbladder](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28311_UBE2QL1-Antibody-Immunohistochemistry-Paraffin-NBP2-34154-img0002.jpg)
Immunohistochemistry-Paraffin: UBE2QL1 Antibody [NBP2-34154] - gallbladder
![Immunohistochemistry-Paraffin: UBE2QL1 Antibody [NBP2-34154] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28312_UBE2QL1-Antibody-Immunohistochemistry-Paraffin-NBP2-34154-img0001.jpg)
Immunohistochemistry-Paraffin: UBE2QL1 Antibody [NBP2-34154] - Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
![Immunohistochemistry-Paraffin: UBE2QL1 Antibody [NBP2-34154] - stomach cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28313_UBE2QL1%2520Antibody-Immunohistochemistry-Paraffin-NBP2-34154-img0003.jpg)
Immunohistochemistry-Paraffin: UBE2QL1 Antibody [NBP2-34154] - stomach cancer