MARCH10 Antibody
| Name | MARCH10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89834 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NSPQVLSEFSGPPLTPTTVGGPRKASFRFRDEDFYSILSLNSRRESDDTEEETQSEECLWVGVRSPCSPSHHK |
| Description | Rabbit Polyclonal |
| Gene | MARCH10 |
| Supplier Page | Shop |
Product images
![Western Blot: MARCH10 Antibody [NBP1-89834] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407404)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28382_MARCH10-Antibody-Western-Blot-NBP1-89834-img0004.jpg)
Western Blot: MARCH10 Antibody [NBP1-89834] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407404)
![Immunohistochemistry: MARCH10 Antibody [NBP1-89834] - Staining of human cerebellum shows strong nuclear and cytoplasmic positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28383_MARCH10-Antibody-Immunohistochemistry-NBP1-89834-img0003.jpg)
Immunohistochemistry: MARCH10 Antibody [NBP1-89834] - Staining of human cerebellum shows strong nuclear and cytoplasmic positivity in Purkinje cells.