SZT2 Antibody

Name SZT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-89886
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:FTSLSVGLPETLKPLISAQPPQWRCYARLVNPQHVFLTFLPATFSDVQRLAACGLEGPPQEETKPKFGDWSG
Purity/Format Immunogen affinity purified
Blocking Peptide SZT2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SZT2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.