TEM Antibody
| Name | TEM Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89939 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | TEM Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TNMD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: TEM Antibody [NBP1-89939] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7063_TEM%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89939-img0003.jpg)
![Immunohistochemistry-Paraffin: TEM Antibody [NBP1-89939] - Staining of human cerebellum shows strong nuclear positivity in purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7064_TEM%2520Antibody-Immunohistochemistry-Paraffin-NBP1-89939-img0002.jpg)