BEND7 Antibody
| Name | BEND7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89913 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SILSNYTRSGSLLFRKLVCAFFDDKTLANSLPNGKRKRGLNDNRKGLDQNIVGAIKVFTEKYCTANHVDKLPGPRDWVQILQDQIK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BEND7 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BEND7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: BEND7 Antibody [NBP1-89913] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli fibrillar center & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25304_BEND7%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89913-img0004.jpg)
Immunocytochemistry/Immunofluorescence: BEND7 Antibody [NBP1-89913] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli fibrillar center & vesicles.
![Immunohistochemistry-Paraffin: BEND7 Antibody [NBP1-89913] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/25305_BEND7-Antibody-Immunohistochemistry-Paraffin-NBP1-89913-img0002.jpg)
Immunohistochemistry-Paraffin: BEND7 Antibody [NBP1-89913] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.