FAM204A Antibody
| Name | FAM204A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-90035 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MWSGLLPPGLNESDAESNSEDEATLENSGLNLQEDKEDESIRKTEIIDFSTDEPKTETESNVNAYEECPSGIPID |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM204A Protein |
| Description | Rabbit Polyclonal |
| Gene | FAM204A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: FAM204A Antibody [NBP1-90035] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6791_FAM204A%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90035-img0005.jpg)
Immunocytochemistry/Immunofluorescence: FAM204A Antibody [NBP1-90035] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
![Immunohistochemistry-Paraffin: FAM204A Antibody [NBP1-90035] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6792_FAM204A-Antibody-Immunohistochemistry-Paraffin-NBP1-90035-img0004.jpg)
Immunohistochemistry-Paraffin: FAM204A Antibody [NBP1-90035] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.