C4orf17 Antibody
| Name | C4orf17 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31819 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: STPGSCSSGMTSTKNDVKANTICIPNYLDQEIKILAKLCSILHTDSLAEVLQWLLHATSKEKEWVSALIHSELAEINLLTHHRRNTSMEPAAETGKPP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C4orf17 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | C4orf17 |
| Supplier Page | Shop |
![Immunohistochemistry: C4orf17 Antibody [NBP2-31819] - colorectal cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28600_C4orf17-Antibody-Immunohistochemistry-NBP2-31819-img0007.jpg)
![Immunohistochemistry: C4orf17 Antibody [NBP2-31819] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28601_C4orf17-Antibody-Immunohistochemistry-NBP2-31819-img0001.jpg)
![Immunohistochemistry: C4orf17 Antibody [NBP2-31819] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28602_C4orf17-Antibody-Immunohistochemistry-NBP2-31819-img0002.jpg)