EIF1AD Antibody
| Name | EIF1AD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31728 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: EEGEKVKAEISFVLCKDHVRSLQKEGFWPEAFSEVAEKHNNRNRQTQPELPAEPQLSGEESSSEDDSDLFV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EIF1AD Protein |
| Description | Rabbit Polyclonal |
| Gene | EIF1AD |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: EIF1AD Antibody [NBP2-31728] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/555_EIF1AD-Antibody-Immunohistochemistry-Paraffin-NBP2-31728-img0007.jpg)
Immunohistochemistry-Paraffin: EIF1AD Antibody [NBP2-31728] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.