ZPBP1 Antibody
| Name | ZPBP1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31726 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LSCEISLLKSECHRVKMQRAGLQNELFFAFSVSSLDTEKGPKRCTDHNCEPYKRLFKAKNLIERFFNQQVEILG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ZPBP1 Protein |
| Description | Rabbit Polyclonal |
| Gene | ZPBP |
| Supplier Page | Shop |
![Immunohistochemistry: ZPBP1 Antibody [NBP2-31726] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28647_ZPBP1-Antibody-Immunohistochemistry-NBP2-31726-img0007.jpg)
![Immunohistochemistry: ZPBP1 Antibody [NBP2-31726] - Immunohistochemical staining of human testis shows strong cytoplasmic positivity in subset of cells in seminiferus ducts](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28648_ZPBP1-Antibody-Immunohistochemistry-NBP2-31726-img0001.jpg)
![Immunohistochemistry: ZPBP1 Antibody [NBP2-31726] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28649_ZPBP1-Antibody-Immunohistochemistry-NBP2-31726-img0002.jpg)