PPPDE1 Antibody
| Name | PPPDE1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31757 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PPPDE1 Protein |
| Description | Rabbit Polyclonal |
| Gene | DESI2 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: PPPDE1 Antibody [NBP2-31757] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28659_PPPDE1%2520Antibody-Immunohistochemistry-NBP2-31757-img0006.jpg)
Immunohistochemistry: PPPDE1 Antibody [NBP2-31757] - liver cancer
![Immunohistochemistry: PPPDE1 Antibody [NBP2-31757] - Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in subset of cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28660_PPPDE1-Antibody-Immunohistochemistry-NBP2-31757-img0001.jpg)
Immunohistochemistry: PPPDE1 Antibody [NBP2-31757] - Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in subset of cells in seminiferus ducts.
![Immunohistochemistry: PPPDE1 Antibody [NBP2-31757] - small intestine](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28661_PPPDE1-Antibody-Immunohistochemistry-NBP2-31757-img0002.jpg)
Immunohistochemistry: PPPDE1 Antibody [NBP2-31757] - small intestine