BEX2 Antibody
| Name | BEX2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31553 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RFRVRQPILQYRWDIMHRLGEPQARMREENMERIGEEVRQLME |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | BEX2 |
| Supplier Page | Shop |
![Immunohistochemistry: BEX2 Antibody [NBP2-31553] - liver cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28665_BEX2-Antibody-Immunohistochemistry-NBP2-31553-img0003.jpg)
![Immunohistochemistry: BEX2 Antibody [NBP2-31553] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in endothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28666_BEX2-Antibody-Immunohistochemistry-NBP2-31553-img0001.jpg)
![Immunohistochemistry: BEX2 Antibody [NBP2-31553] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28667_BEX2-Antibody-Immunohistochemistry-NBP2-31553-img0002.jpg)