IAH1 Antibody
| Name | IAH1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-31391 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: PRLLLFGDSITQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNSLDIPVAVTIFFGANDSALKDENPK |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | IAH1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: IAH1 Antibody [NBP2-31391] - breast cancer](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28668_IAH1-Antibody-Immunohistochemistry-NBP2-31391-img0003.jpg)
Immunohistochemistry: IAH1 Antibody [NBP2-31391] - breast cancer
![Immunohistochemistry: IAH1 Antibody [NBP2-31391] - Staining of human vulva/anal skin shows distinct positivity in erythrocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28669_IAH1-Antibody-Immunohistochemistry-NBP2-31391-img0001.jpg)
Immunohistochemistry: IAH1 Antibody [NBP2-31391] - Staining of human vulva/anal skin shows distinct positivity in erythrocytes.
![Immunohistochemistry: IAH1 Antibody [NBP2-31391] - liver](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28670_IAH1-Antibody-Immunohistochemistry-NBP2-31391-img0002.jpg)
Immunohistochemistry: IAH1 Antibody [NBP2-31391] - liver
![Western Blot: IAH1 Antibody [NBP2-31391] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: MOLT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/29_IAH1%2520Antibody-Western%2520Blot-NBP2-31391-img0004.jpg)
Western Blot: IAH1 Antibody [NBP2-31391] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: MOLT-4