Dlx1 Antibody
| Name | Dlx1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91837 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Dlx1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | DLX1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Dlx1 Antibody [NBP1-91837] - Analysis in human cell line HEK 293.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12861_Dlx1-Antibody-Western-Blot-NBP1-91837-img0003.jpg)
Western Blot: Dlx1 Antibody [NBP1-91837] - Analysis in human cell line HEK 293.
![Immunohistochemistry-Paraffin: Dlx1 Antibody [NBP1-91837] - Staining of human cerebellum shows strong positivity in nerve fibers.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12862_Dlx1-Antibody-Immunohistochemistry-Paraffin-NBP1-91837-img0004.jpg)
Immunohistochemistry-Paraffin: Dlx1 Antibody [NBP1-91837] - Staining of human cerebellum shows strong positivity in nerve fibers.
![Immunohistochemistry-Paraffin: Dlx1 Antibody [NBP1-91837] - Staining of human testis shows distinct cytoplasmic positivity in acrosomal cap of spermatids.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/12863_Dlx1-Antibody-Immunohistochemistry-Paraffin-NBP1-91837-img0002.jpg)
Immunohistochemistry-Paraffin: Dlx1 Antibody [NBP1-91837] - Staining of human testis shows distinct cytoplasmic positivity in acrosomal cap of spermatids.