FAM113B Antibody
| Name | FAM113B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91879 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LVWNTAMPVGEEVTGGFLPPKLRRQKATFLKNEVVKANFHSATEARKHNFDVLD |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FAM113B Protein |
| Description | Rabbit Polyclonal |
| Gene | PCED1B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FAM113B Antibody [NBP1-91879] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17677_FAM113B-Antibody-Western-Blot-NBP1-91879-img0005.jpg)
Western Blot: FAM113B Antibody [NBP1-91879] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
![Immunocytochemistry/Immunofluorescence: FAM113B Antibody [NBP1-91879] - Staining of human cell line A549 shows localization to the Golgi apparatus & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17678_FAM113B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91879-img0006.jpg)
Immunocytochemistry/Immunofluorescence: FAM113B Antibody [NBP1-91879] - Staining of human cell line A549 shows localization to the Golgi apparatus & vesicles.
![Immunohistochemistry-Paraffin: FAM113B Antibody [NBP1-91879] - Staining of human skin shows distinct cytoplasmic positivity in Langerhans cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17679_FAM113B-Antibody-Immunohistochemistry-Paraffin-NBP1-91879-img0007.jpg)
Immunohistochemistry-Paraffin: FAM113B Antibody [NBP1-91879] - Staining of human skin shows distinct cytoplasmic positivity in Langerhans cells.