ITPRIP Antibody
| Name | ITPRIP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92031 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RAWKGIAHKYEFDLAFGQLDSPGSLKIKFRSGKFMPFNLIPVIQCDDSDLYFVSHLPREPSEGTPASSTDWLLSF |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ITPRIP Protein |
| Description | Rabbit Polyclonal |
| Gene | ITPRIP |
| Supplier Page | Shop |
Product images
![Western Blot: ITPRIP Antibody [NBP1-92031] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28793_ITPRIP%2520Antibody-Western%2520Blot-NBP1-92031-img0004.jpg)
Western Blot: ITPRIP Antibody [NBP1-92031] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
![Immunohistochemistry-Paraffin: ITPRIP Antibody [NBP1-92031] - Staining of human kidney shows strong cytoplasmic positivity in tubular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28794_ITPRIP-Antibody-Immunohistochemistry-Paraffin-NBP1-92031-img0002.jpg)
Immunohistochemistry-Paraffin: ITPRIP Antibody [NBP1-92031] - Staining of human kidney shows strong cytoplasmic positivity in tubular cells.