MARVELD3 Antibody
| Name | MARVELD3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92099 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GGGFGNNYYSPFEGTELEQVRQLDQQYTILR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MARVELD3 Protein |
| Description | Rabbit Polyclonal |
| Gene | MARVELD3 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: MARVELD3 Antibody [NBP1-92099] - Staining of human cell line U-2 OS shows positivity in vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2977_MARVELD3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92099-img0004.jpg)
![Immunohistochemistry-Paraffin: MARVELD3 Antibody [NBP1-92099] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/2978_MARVELD3-Antibody-Immunohistochemistry-Paraffin-NBP1-92099-img0005.jpg)