LRRC44 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-92078
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:MFHGTVTEELTSHEEWSHYNENIREGQKDFVFVKFNGLHLKSMENLQSCISLRVCIFSNNFITDIHPLQSCIKLIKLDLHGN
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: LRRC44 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: LRRIQ3
• Conjugate: Unconjugated

Product images

Western Blot: LRRC44 Antibody [NBP1-92078] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: LRRC44 Antibody [NBP1-92078] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.

Immunohistochemistry-Paraffin: LRRC44 Antibody [NBP1-92078] - Staining of human testis shows strong cytoplasmic positivity in spermatozoa.