MRPS24 Antibody
| Name | MRPS24 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92140 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKY |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MRPS24 Protein |
| Description | Rabbit Polyclonal |
| Gene | MRPS24 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MRPS24 Antibody [NBP1-92140] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/21037_MRPS24-Antibody-Western-Blot-NBP1-92140-img0006.jpg)
Western Blot: MRPS24 Antibody [NBP1-92140] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
![Immunohistochemistry-Paraffin: MRPS24 Antibody [NBP1-92140] - Staining of human colon shows strong cytoplasmic positivity in goblet cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/21038_MRPS24-Antibody-Immunohistochemistry-Paraffin-NBP1-92140-img0002.jpg)
Immunohistochemistry-Paraffin: MRPS24 Antibody [NBP1-92140] - Staining of human colon shows strong cytoplasmic positivity in goblet cells.
![Western Blot: MRPS24 Antibody [NBP1-92140] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/21039_MRPS24-Antibody-Western-Blot-NBP1-92140-img0005.jpg)
Western Blot: MRPS24 Antibody [NBP1-92140] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp