MMP26 Antibody
| Name | MMP26 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92127 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:DFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWN |
| Description | Rabbit Polyclonal |
| Gene | MMP26 |
| Supplier Page | Shop |
Product images
![Western Blot: MMP26 Antibody [NBP1-92127] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411921)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28919_MMP26%2520Antibody-Western%2520Blot-NBP1-92127-img0003.jpg)
Western Blot: MMP26 Antibody [NBP1-92127] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411921)
![Immunohistochemistry-Paraffin: MMP26 Antibody [NBP1-92127] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28920_MMP26-Antibody-Immunohistochemistry-Paraffin-NBP1-92127-img0002.jpg)
Immunohistochemistry-Paraffin: MMP26 Antibody [NBP1-92127] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.