NMDARA1 Antibody
| Name | NMDARA1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92187 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PYGQPQVFPGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NMDARA1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GRINA |
| Supplier Page | Shop |
Product images
![Western Blot: NMDARA1 Antibody [NBP1-92187] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422906)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28939_NMDARA1-Antibody-Western-Blot-NBP1-92187-img0004.jpg)
Western Blot: NMDARA1 Antibody [NBP1-92187] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422906)
![Immunohistochemistry: NMDARA1 Antibody [NBP1-92187] - Staining of human urinary bladder shows moderate cytoplasmic, membrane and nucleolar positivity in urothelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/28940_NMDARA1-Antibody-Immunohistochemistry-NBP1-92187-img0003.jpg)
Immunohistochemistry: NMDARA1 Antibody [NBP1-92187] - Staining of human urinary bladder shows moderate cytoplasmic, membrane and nucleolar positivity in urothelial cells.