RCOR2 Antibody
| Name | RCOR2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92323 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PSVMEKPSAGSGILSRSRAKTVPNGGQPHSEDDSSEEEHSHDSMIRVGTNYQAVIPECKPESPARYSNKELKGMLVWSPNHCVSDAK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RCOR2 Protein |
| Description | Rabbit Polyclonal |
| Gene | RCOR2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RCOR2 Antibody [NBP1-92323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17361_RCOR2-Antibody-Western-Blot-NBP1-92323-img0004.jpg)
Western Blot: RCOR2 Antibody [NBP1-92323] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
![Immunocytochemistry/Immunofluorescence: RCOR2 Antibody [NBP1-92323] - Staining of human cell line Hep G2 shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17362_RCOR2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92323-img0005.jpg)
Immunocytochemistry/Immunofluorescence: RCOR2 Antibody [NBP1-92323] - Staining of human cell line Hep G2 shows localization to nucleus.
![Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17363_RCOR2%2520Antibody-Immunohistochemistry-Paraffin-NBP1-92323-img0006.jpg)
Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human cerebral cortex shows moderate cytoplasmic and nuclear positivity in neuronal cells.
![Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/17364_RCOR2-Antibody-Immunohistochemistry-Paraffin-NBP1-92323-img0002.jpg)
Immunohistochemistry-Paraffin: RCOR2 Antibody [NBP1-92323] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.