POP4 Antibody
| Name | POP4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92281 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | POP4 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | POP4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: POP4 Antibody [NBP1-92281] - Analysis in human cell line A-549.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26067_POP4-Antibody-Western-Blot-NBP1-92281-img0006.jpg)
Western Blot: POP4 Antibody [NBP1-92281] - Analysis in human cell line A-549.
![Immunohistochemistry-Paraffin: POP4 Antibody [NBP1-92281] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26068_POP4-Antibody-Immunohistochemistry-Paraffin-NBP1-92281-img0007.jpg)
Immunohistochemistry-Paraffin: POP4 Antibody [NBP1-92281] - Staining of human kidney shows moderate nuclear positivity in cells in tubules.
![Immunohistochemistry-Paraffin: POP4 Antibody [NBP1-92281] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26069_POP4-Antibody-Immunohistochemistry-Paraffin-NBP1-92281-img0002.jpg)
Immunohistochemistry-Paraffin: POP4 Antibody [NBP1-92281] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.